PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.M01577.1.p
Common NameLOC105968900, MIMGU_mgv1a002460mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family WRKY
Protein Properties Length: 672aa    MW: 73032.1 Da    PI: 5.5214
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.M01577.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY100.69.4e-32293349259
                       --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
              WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                       +Dgy+WrKYGqK+vkgsefprsYY+Ct ++C+vkkkvers+ +++++ei+Y+g+Hnh 
  Migut.M01577.1.p 293 EDGYSWRKYGQKQVKGSEFPRSYYKCTDQNCSVKKKVERSN-EGHITEIIYKGTHNHL 349
                       7****************************************.***************5 PP

2WRKY102.22.9e-32487545159
                       ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
              WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                       ldDgy+WrKYGqK+vkg+++prsYY+CtsagC+v+k+ver+ +d k v++tYeg+Hnh+
  Migut.M01577.1.p 487 LDDGYRWRKYGQKVVKGNPNPRSYYKCTSAGCNVRKHVERACNDLKSVITTYEGKHNHD 545
                       59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007744.7E-34292350IPR003657WRKY domain
SuperFamilySSF1182904.05E-24292351IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.2E-27292351IPR003657WRKY domain
PfamPF031065.6E-25293348IPR003657WRKY domain
PROSITE profilePS5081122.596293351IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.4E-36472547IPR003657WRKY domain
SuperFamilySSF1182902.48E-28479547IPR003657WRKY domain
PROSITE profilePS5081138.136482547IPR003657WRKY domain
SMARTSM007743.4E-36487546IPR003657WRKY domain
PfamPF031061.6E-24488545IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009555Biological Processpollen development
GO:0009942Biological Processlongitudinal axis specification
GO:0030010Biological Processestablishment of cell polarity
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 672 aa     Download sequence    Send to blast
MGGFDDHIAV MGDWMLTPNP SPRGFFSSIM GDDVAITQPI TNSAFEFSGP PFRGPEENVV  60
TQASVGGDEA SKSYGVGEPR SSSRGGLLER IAARAGFNAP RLDTESMIRT TDLSKKQEVQ  120
SPYLTIPPGL SPTSLLDSPV FLTNSLFLPS PTTGQFQFAA SGNNPGSELM AVDSDKNKEN  180
NFENISNVPS FTFKPIAESA SFSYFNATNK SFPSDGAVSN GQSKNNDELF QQFKQADFSK  240
MQTENNGGSN LLHEQTYNSV VAADHSPPLD EQNQDGDLRS SAGDPHLGGG ASEDGYSWRK  300
YGQKQVKGSE FPRSYYKCTD QNCSVKKKVE RSNEGHITEI IYKGTHNHLK PPPNRRSIIG  360
GFSNSLGCDM QIDSEEQQPG SGGGEVGDLV WSAMQNGNDV VGPTDWKQEN LETQSGAHHY  420
EAGDGASPFT NDEEVEEERA THDAEGDELD SKRRKIEAYA PEMNVGATRA IREPRVVVQT  480
TSEVDILDDG YRWRKYGQKV VKGNPNPRSY YKCTSAGCNV RKHVERACND LKSVITTYEG  540
KHNHDVPAAR NSVQMNALGS GSLASTRHSP AVSNNNMNRV DPSQNRGWFE RPPSASFGQP  600
GSRPRGFGPG SGFGSMGLGG WGNNPGRLPG HRYLGNNQML QPKDEPEMEP VRDNGFGSSA  660
AYHQLMSRLP M*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A6e-37293548878Probable WRKY transcription factor 4
1wj2_A6e-37293548878Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00071PBMTransfer from AT5G56270Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012849048.10.0PREDICTED: probable WRKY transcription factor 2
TrEMBLA0A022QM210.0A0A022QM21_ERYGU; Uncharacterized protein
STRINGVIT_19s0015g01870.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA37112341
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56270.11e-148WRKY DNA-binding protein 2